FGD5 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086333
Article Name: FGD5 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086333
Supplier Catalog Number: orb2086333
Alternative Catalog Number: BYT-ORB2086333-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGD5
Conjugation: Biotin
Alternative Names: ZFYVE23
FGD5 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 59kDa
UniProt: Q6ZNL6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK