HGH1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086343
Article Name: HGH1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086343
Supplier Catalog Number: orb2086343
Alternative Catalog Number: BYT-ORB2086343-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM203A
Conjugation: HRP
Alternative Names: BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30B
HGH1 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 057542
UniProt: Q9BTY7
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DFSEEEMERLPVDLQYLPPDKQREPDADIRKMLVEAIMLLTATAPGRQQV