HGH1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086347
Article Name: |
HGH1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086347 |
Supplier Catalog Number: |
orb2086347 |
Alternative Catalog Number: |
BYT-ORB2086347-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM203A |
Conjugation: |
FITC |
Alternative Names: |
BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30B |
HGH1 Antibody - C-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
41kDa |
NCBI: |
057542 |
UniProt: |
Q9BTY7 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: ADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACE |