FAM198B Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086351
Article Name: FAM198B Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086351
Supplier Catalog Number: orb2086351
Alternative Catalog Number: BYT-ORB2086351-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM198B
Conjugation: Biotin
Alternative Names: ENED, AD021, AD036, C4orf18, FAM198B
FAM198B Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 001026870
UniProt: Q6UWH4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAA