FAM193A Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086356
Article Name: FAM193A Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086356
Supplier Catalog Number: orb2086356
Alternative Catalog Number: BYT-ORB2086356-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A
Conjugation: FITC
Alternative Names: C4orf8, RES4-22
FAM193A Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 139kDa
NCBI: 003695
UniProt: P78312
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA