FAM192A Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086358
Article Name: FAM192A Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086358
Supplier Catalog Number: orb2086358
Alternative Catalog Number: BYT-ORB2086358-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM192A
Conjugation: HRP
Alternative Names: CDA10, NIP30, PIP30, CDA018, FAM192A, C16orf94
FAM192A Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 079222
UniProt: Q9GZU8
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCK