MINDY4 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086362
| Article Name: |
MINDY4 Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2086362 |
| Supplier Catalog Number: |
orb2086362 |
| Alternative Catalog Number: |
BYT-ORB2086362-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM188B |
| Conjugation: |
FITC |
| Alternative Names: |
AQP1, AQP-1, CHIP28, C7orf67, FAM188B |
| MINDY4 Antibody - N-terminal region : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
84kDa |
| NCBI: |
115598 |
| UniProt: |
Q4G0A6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: HSEPSLDVKRMGENSRPKSGLIVRGMMSGPIASSPQDSFHRHYLRRSSPS |
