FAM185A Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086368
Article Name: FAM185A Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086368
Supplier Catalog Number: orb2086368
Alternative Catalog Number: BYT-ORB2086368-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM185A
Conjugation: FITC
FAM185A Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 001138741
UniProt: Q8N0U4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EVHVQEMAEVRKDDVVTVTGLMNQASKREKWIKADAPKGTVSFRRQSWFQ