FAM181B Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086377
Article Name: |
FAM181B Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2086377 |
Supplier Catalog Number: |
orb2086377 |
Alternative Catalog Number: |
BYT-ORB2086377-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM181B |
Conjugation: |
FITC |
FAM181B Antibody - N-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
42kDa |
NCBI: |
787081 |
UniProt: |
A6NEQ2 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: LSGAEGGDVREATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQ |