FAM181B Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086378
Article Name: FAM181B Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086378
Supplier Catalog Number: orb2086378
Alternative Catalog Number: BYT-ORB2086378-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM181B
Conjugation: Biotin
FAM181B Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 787081
UniProt: A6NEQ2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LSGAEGGDVREATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQ