FAM177B Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2086383
| Article Name: |
FAM177B Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2086383 |
| Supplier Catalog Number: |
orb2086383 |
| Alternative Catalog Number: |
BYT-ORB2086383-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM177B |
| Conjugation: |
FITC |
| FAM177B Antibody - N-terminal region : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
13kDa |
| UniProt: |
A6PVY3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDP |
