FAM171A2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2086388
Article Name: FAM171A2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2086388
Supplier Catalog Number: orb2086388
Alternative Catalog Number: BYT-ORB2086388-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM171A2
Conjugation: HRP
FAM171A2 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 84kDa
NCBI: 940877
UniProt: A8MVW0
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SSRSSASELRRDSLTSPEDELGAEVGDEAGDKKSPWQRREERPLMVFNVK