GADL1 Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098505
Article Name: GADL1 Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098505
Supplier Catalog Number: orb2098505
Alternative Catalog Number: BYT-ORB2098505-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GADL1
Conjugation: HRP
Alternative Names: ADC, CSADC, HuADC, HuCSADC
GADL1 Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 997242
UniProt: Q6ZQY3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKAL