GADL1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098507
| Article Name: |
GADL1 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098507 |
| Supplier Catalog Number: |
orb2098507 |
| Alternative Catalog Number: |
BYT-ORB2098507-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human GADL1 |
| Conjugation: |
Biotin |
| Alternative Names: |
ADC, CSADC, HuADC, HuCSADC |
| GADL1 Antibody - middle region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
57kDa |
| NCBI: |
997242 |
| UniProt: |
Q6ZQY3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: DLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKAL |
