SLC6A11 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098513
Article Name: SLC6A11 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098513
Supplier Catalog Number: orb2098513
Alternative Catalog Number: BYT-ORB2098513-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC6A11
Conjugation: Biotin
Alternative Names: GAT3, GAT4, GAT-3
SLC6A11 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 055044
UniProt: P48066
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAIT