COCH Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098517
Article Name: COCH Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098517
Supplier Catalog Number: orb2098517
Alternative Catalog Number: BYT-ORB2098517-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COCH
Conjugation: HRP
Alternative Names: DFNA9, COCH5B2, DFNB110, COCH-5B2
COCH Antibody - N-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 001128530
UniProt: O43405
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGK