COCH Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098518
Article Name: COCH Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098518
Supplier Catalog Number: orb2098518
Alternative Catalog Number: BYT-ORB2098518-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COCH
Conjugation: FITC
Alternative Names: DFNA9, COCH5B2, DFNB110, COCH-5B2
COCH Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 001128530
UniProt: O43405
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGK