COCH Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098522
| Article Name: |
COCH Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098522 |
| Supplier Catalog Number: |
orb2098522 |
| Alternative Catalog Number: |
BYT-ORB2098522-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human COCH |
| Conjugation: |
Biotin |
| Alternative Names: |
DFNA9, COCH5B2, DFNB110, COCH-5B2 |
| COCH Antibody - C-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
57kDa |
| NCBI: |
001128530 |
| UniProt: |
O43405 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ |
