CLRN1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098525
Article Name: CLRN1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098525
Supplier Catalog Number: orb2098525
Alternative Catalog Number: BYT-ORB2098525-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLRN1
Conjugation: Biotin
Alternative Names: RP61, USH3, USH3A
CLRN1 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 777367
UniProt: P58418
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADL