CLRN1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098525
| Article Name: |
CLRN1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098525 |
| Supplier Catalog Number: |
orb2098525 |
| Alternative Catalog Number: |
BYT-ORB2098525-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLRN1 |
| Conjugation: |
Biotin |
| Alternative Names: |
RP61, USH3, USH3A |
| CLRN1 Antibody - C-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
26kDa |
| NCBI: |
777367 |
| UniProt: |
P58418 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADL |
