BSND Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098527
Article Name: |
BSND Antibody - middle region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2098527 |
Supplier Catalog Number: |
orb2098527 |
Alternative Catalog Number: |
BYT-ORB2098527-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human BSND |
Conjugation: |
FITC |
Alternative Names: |
BART, DFNB73 |
BSND Antibody - middle region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
35 kDa |
NCBI: |
476517 |
UniProt: |
Q8WZ55 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: PGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDD |