ZDHHC3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098533
Article Name: ZDHHC3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098533
Supplier Catalog Number: orb2098533
Alternative Catalog Number: BYT-ORB2098533-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZDHHC3
Conjugation: FITC
Alternative Names: GODZ, DHHC3, DHHC-3, ZNF373
ZDHHC3 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001128651
UniProt: Q9NYG2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP