ZDHHC3 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098534
| Article Name: |
ZDHHC3 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098534 |
| Supplier Catalog Number: |
orb2098534 |
| Alternative Catalog Number: |
BYT-ORB2098534-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZDHHC3 |
| Conjugation: |
Biotin |
| Alternative Names: |
GODZ, DHHC3, DHHC-3, ZNF373 |
| ZDHHC3 Antibody - C-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
34kDa |
| NCBI: |
001128651 |
| UniProt: |
Q9NYG2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP |
