OPRL1 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098540
Article Name: OPRL1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098540
Supplier Catalog Number: orb2098540
Alternative Catalog Number: BYT-ORB2098540-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OPRL1
Conjugation: Biotin
Alternative Names: NOP, OOR, KOR3, NOPr, OPRL, ORL1, KOR-3, NOCIR
OPRL1 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 872588
UniProt: P79292
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ