NPFFR2 Antibody - middle region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098542
Article Name: NPFFR2 Antibody - middle region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098542
Supplier Catalog Number: orb2098542
Alternative Catalog Number: BYT-ORB2098542-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPFFR2
Conjugation: FITC
Alternative Names: GPR74, NPFF2, NPGPR, HLWAR77
NPFFR2 Antibody - middle region : FITC
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 444264
UniProt: A0PJM9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA