NPFFR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098544
| Article Name: |
NPFFR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098544 |
| Supplier Catalog Number: |
orb2098544 |
| Alternative Catalog Number: |
BYT-ORB2098544-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human NPFFR2 |
| Conjugation: |
HRP |
| Alternative Names: |
GPR74, NPFF2, NPGPR, HLWAR77 |
| NPFFR2 Antibody - C-terminal region : HRP |
| Clonality: |
Polyclonal |
| Molecular Weight: |
46kDa |
| NCBI: |
444264 |
| UniProt: |
A0PJM9 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT |
