NPFFR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098546
Article Name: NPFFR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098546
Supplier Catalog Number: orb2098546
Alternative Catalog Number: BYT-ORB2098546-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NPFFR2
Conjugation: Biotin
Alternative Names: GPR74, NPFF2, NPGPR, HLWAR77
NPFFR2 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 444264
UniProt: A0PJM9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT