SSR5 Antibody - middle region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098549
| Article Name: |
SSR5 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098549 |
| Supplier Catalog Number: |
orb2098549 |
| Alternative Catalog Number: |
BYT-ORB2098549-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SSR5 |
| Conjugation: |
Biotin |
| Alternative Names: |
SS-5-R |
| SSR5 Antibody - middle region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
40 kDa |
| NCBI: |
001044 |
| UniProt: |
P35346 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGC |
