SSTR2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098552
| Article Name: |
SSTR2 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098552 |
| Supplier Catalog Number: |
orb2098552 |
| Alternative Catalog Number: |
BYT-ORB2098552-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SSTR2 |
| Conjugation: |
Biotin |
| SSTR2 Antibody - middle region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
41kDa |
| NCBI: |
001041 |
| UniProt: |
P30874 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL |
