SSTR1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098557
Article Name: SSTR1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098557
Supplier Catalog Number: orb2098557
Alternative Catalog Number: BYT-ORB2098557-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SSTR1
Conjugation: FITC
Alternative Names: SS1R, SS1-R, SRIF-2, SS-1-R
SSTR1 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 001040
UniProt: P28646
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD