SSTR1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098558
| Article Name: |
SSTR1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098558 |
| Supplier Catalog Number: |
orb2098558 |
| Alternative Catalog Number: |
BYT-ORB2098558-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human SSTR1 |
| Conjugation: |
Biotin |
| Alternative Names: |
SS1R, SS1-R, SRIF-2, SS-1-R |
| SSTR1 Antibody - C-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
43kDa |
| NCBI: |
001040 |
| UniProt: |
P28646 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD |
