Sstr1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098561
Article Name: |
Sstr1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2098561 |
Supplier Catalog Number: |
orb2098561 |
Alternative Catalog Number: |
BYT-ORB2098561-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Sstr1 |
Conjugation: |
Biotin |
Alternative Names: |
ss, Sms, SS1R, Smst, sst1, SS1-R, SRIF-2, SS-1-R, Smstr1, Smstr-1 |
Sstr1 Antibody - C-terminal region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
43kDa |
NCBI: |
033242 |
UniProt: |
P30873 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC |