PCSK2 Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098563
| Article Name: |
PCSK2 Antibody - middle region : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098563 |
| Supplier Catalog Number: |
orb2098563 |
| Alternative Catalog Number: |
BYT-ORB2098563-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human PCSK2 |
| Conjugation: |
FITC |
| Alternative Names: |
PC2, NEC2, SPC2, NEC 2, NEC-2 |
| PCSK2 Antibody - middle region : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
58kDa |
| NCBI: |
002585 |
| UniProt: |
Q5REC2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA |
