TAC1 Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098572
Article Name: |
TAC1 Antibody - middle region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2098572 |
Supplier Catalog Number: |
orb2098572 |
Alternative Catalog Number: |
BYT-ORB2098572-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TAC1 |
Conjugation: |
FITC |
Alternative Names: |
NK2, NPK, NKNA, TAC2, Hs.2563 |
TAC1 Antibody - middle region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
13kDa |
NCBI: |
054703 |
UniProt: |
P20366 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH |