AVPR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098580
Article Name: AVPR2 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098580
Supplier Catalog Number: orb2098580
Alternative Catalog Number: BYT-ORB2098580-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AVPR2
Conjugation: HRP
Alternative Names: DI1, DIR, NDI, V2R, ADHR, DIR3
AVPR2 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 000045
UniProt: P30518
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS