AVPR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098582
Article Name: AVPR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098582
Supplier Catalog Number: orb2098582
Alternative Catalog Number: BYT-ORB2098582-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AVPR2
Conjugation: Biotin
Alternative Names: DI1, DIR, NDI, V2R, ADHR, DIR3
AVPR2 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 000045
UniProt: P30518
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS