Vamp8 Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098583
Article Name: Vamp8 Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098583
Supplier Catalog Number: orb2098583
Alternative Catalog Number: BYT-ORB2098583-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Vamp8
Conjugation: HRP
Vamp8 Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 114015
UniProt: Q9WUF4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL