STX4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098593
Article Name: STX4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098593
Supplier Catalog Number: orb2098593
Alternative Catalog Number: BYT-ORB2098593-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STX4
Conjugation: FITC
Alternative Names: STX4A, p35-2
STX4 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 004595
UniProt: Q12846
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV