STX4 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098594
| Article Name: |
STX4 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098594 |
| Supplier Catalog Number: |
orb2098594 |
| Alternative Catalog Number: |
BYT-ORB2098594-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human STX4 |
| Conjugation: |
Biotin |
| Alternative Names: |
STX4A, p35-2 |
| STX4 Antibody - C-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
34kDa |
| NCBI: |
004595 |
| UniProt: |
Q12846 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV |
