STX3 Antibody - middle region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098600
| Article Name: |
STX3 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098600 |
| Supplier Catalog Number: |
orb2098600 |
| Alternative Catalog Number: |
BYT-ORB2098600-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human STX3 |
| Conjugation: |
Biotin |
| Alternative Names: |
STX3A |
| STX3 Antibody - middle region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
30 kDa |
| NCBI: |
001171511 |
| UniProt: |
Q13277 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD |
