BNIP1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098617
Article Name: BNIP1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098617
Supplier Catalog Number: orb2098617
Alternative Catalog Number: BYT-ORB2098617-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BNIP1
Conjugation: FITC
Alternative Names: NIP1, SEC20, TRG-8
BNIP1 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 001196
UniProt: Q12981
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA