Nckipsd Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098627
Article Name: Nckipsd Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098627
Supplier Catalog Number: orb2098627
Alternative Catalog Number: BYT-ORB2098627-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nckipsd
Conjugation: Biotin
Nckipsd Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 001100327
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEDVIRCYLEELLH