NCKIPSD Antibody - middle region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098629
Article Name: NCKIPSD Antibody - middle region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098629
Supplier Catalog Number: orb2098629
Alternative Catalog Number: BYT-ORB2098629-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NCKIPSD
Conjugation: FITC
Alternative Names: DIP, DIP1, ORF1, WISH, VIP54, AF3P21, SPIN90, WASLBP
NCKIPSD Antibody - middle region : FITC
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 909119
UniProt: Q9NZQ3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLG