CADPS2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098635
Article Name: |
CADPS2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2098635 |
Supplier Catalog Number: |
orb2098635 |
Alternative Catalog Number: |
BYT-ORB2098635-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of human CADPS2 |
Conjugation: |
FITC |
Alternative Names: |
CAPS2 |
CADPS2 Antibody - N-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
85kDa |
NCBI: |
001009571 |
UniProt: |
Q86UW7 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: RFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRA |