CADPS Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098637
Article Name: CADPS Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098637
Supplier Catalog Number: orb2098637
Alternative Catalog Number: BYT-ORB2098637-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAPS1
Conjugation: HRP
Alternative Names: CAPS, CAPS1, CADPS1, UNC-31
CADPS Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 50kDa
UniProt: Q9ULU8
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: EVVIMEVQGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTVIRRNRRE