Rph3a Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098642
Article Name: Rph3a Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098642
Supplier Catalog Number: orb2098642
Alternative Catalog Number: BYT-ORB2098642-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Biotin
Alternative Names: AU022689, AW108370, 2900002P20Rik
Rph3a Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 035416
UniProt: P47708
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR