SYT12 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098653
Article Name: SYT12 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098653
Supplier Catalog Number: orb2098653
Alternative Catalog Number: BYT-ORB2098653-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYT12
Conjugation: FITC
Alternative Names: SYT11, sytXII
SYT12 Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 46 kDa
NCBI: 001171351
UniProt: Q8IV01
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA