SYT12 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2098654
| Article Name: |
SYT12 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2098654 |
| Supplier Catalog Number: |
orb2098654 |
| Alternative Catalog Number: |
BYT-ORB2098654-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SYT12 |
| Conjugation: |
Biotin |
| Alternative Names: |
SYT11, sytXII |
| SYT12 Antibody - N-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
46 kDa |
| NCBI: |
001171351 |
| UniProt: |
Q8IV01 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA |
