SYT11 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098679
Article Name: SYT11 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098679
Supplier Catalog Number: orb2098679
Alternative Catalog Number: BYT-ORB2098679-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYT11
Conjugation: HRP
Alternative Names: SYT12, sytXI
SYT11 Antibody - N-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 689493
UniProt: Q9BT88
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS