SYT11 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098680
Article Name: SYT11 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098680
Supplier Catalog Number: orb2098680
Alternative Catalog Number: BYT-ORB2098680-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYT11
Conjugation: FITC
Alternative Names: SYT12, sytXI
SYT11 Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 689493
UniProt: Q9BT88
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS