SCAMP3 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098690
Article Name: SCAMP3 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098690
Supplier Catalog Number: orb2098690
Alternative Catalog Number: BYT-ORB2098690-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCAMP3
Conjugation: Biotin
Alternative Names: C1orf3
SCAMP3 Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 443069
UniProt: O14828
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FQPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT